General Information

  • ID:  hor002959
  • Uniprot ID:  Q791B0
  • Protein name:  Ubiquitin-like protein 5
  • Gene name:  Ubl5
  • Organism:  Psammomys obesus (Fat sand rat)
  • Family:  NA
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Psammomys (genus), Gerbillinae (subfamily), Muridae (family), Muroidea, Myomorpha (suborder), Rodentia (order), Glires, Euarchontoglires (superorder), Boreoeutheria, Eutheria, Theria, Mammalia (class), Amniota, Tetrapoda, Dipnotetrapodomorpha, Sarcopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  NA
  • GO BP:  GO:0036211 protein modification process
  • GO CC:  GO:0005634 nucleus; GO:0005737 cytoplasm; GO:0015030 Cajal body

Sequence Information

  • Sequence:  MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
  • Length:  73(1-73)
  • Propeptide:  MIEVVCNDRLGKKVRVKCNTDDTIGDLKKLIAAQTGTRWNKIVLKKWYTIFKDHVSLGDYEIHDGMNLELYYQ
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Regulation of energy balance and body weight homeostasis
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:   NA
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  NA
  • Half life:  NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  AF-Q9LXU0-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    AF-Q9LXU0-F1.pdbhor002959_AF2.pdbhor002959_ESM.pdb

Physical Information

Mass: 983142 Formula: C383H611N103O110S4
Absent amino acids: P Common amino acids: K
pI: 8.7 Basic residues: 14
Polar residues: 21 Hydrophobic residues: 24
Hydrophobicity: -41.51 Boman Index: -12853
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 96.03
Instability Index: 1531.1 Extinction Coefficient cystines: 17085
Absorbance 280nm: 237.29

Literature

  • PubMed ID:  NA
  • Title:  NA